Recombinant Human COG8 Protein, GST-tagged

• Cat.No.: COG8-1631H
• Product Overview: Human COG8 full-length ORF ( AAH17492.1, 1 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein that is a component of the conserved oligomeric Golgi (COG) complex, a multiprotein complex that plays a structural role in the Golgi apparatus, and is involved in intracellular membrane trafficking and glycoprotein modification. Mutations in this gene cause congenital disorder of glycosylation, type IIh, a disease that is characterized by under-glycosylated serum proteins, and whose symptoms include severe psychomotor retardation, failure to thrive, seizures, and dairy and wheat product intolerance. [provided by RefSeq, Jul 2008]
• Molecular Mass: 49.7 kDa
• AA Sequence: MNSYMLISAPAILGTSNMPAAVPATQPGTLQPPMVLLDFPPLACFLNNILVAFNDLRLCCPVALAQDVTGALEDALAKVTKIILAFHRAEEAAFSSGEQELFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNLGHVNIGAIQEPLAFILPKRETLFTLDDQALGPELTAPAPEPPAEEPRLEPAGPACPEGGRAETQAEPPSVGP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COG8 component of oligomeric golgi complex 8 [ Homo sapiens ]
• Official Symbol: COG8
• Synonyms: COG8; component of oligomeric golgi complex 8; conserved oligomeric Golgi complex subunit 8; DOR1; FLJ22315; dependent on RIC1; COG complex subunit 8; conserved oligomeric golgi complex component 8; CDG2H
• Gene ID: 84342
• mRNA Refseq: NM_032382
• Protein Refseq: NP_115758
• MIM: 606979
• UniProt ID: Q96MW5