Recombinant Full Length Human COG8 Protein, GST-tagged

Cat.No. : COG8-2085HF
Product Overview : Human COG8 full-length ORF ( AAH17492.1, 1 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 219 amino acids
Description : This gene encodes a protein that is a component of the conserved oligomeric Golgi (COG) complex, a multiprotein complex that plays a structural role in the Golgi apparatus, and is involved in intracellular membrane trafficking and glycoprotein modification. Mutations in this gene cause congenital disorder of glycosylation, type IIh, a disease that is characterized by under-glycosylated serum proteins, and whose symptoms include severe psychomotor retardation, failure to thrive, seizures, and dairy and wheat product intolerance. [provided by RefSeq, Jul 2008]
Molecular Mass : 49.7 kDa
AA Sequence : MNSYMLISAPAILGTSNMPAAVPATQPGTLQPPMVLLDFPPLACFLNNILVAFNDLRLCCPVALAQDVTGALEDALAKVTKIILAFHRAEEAAFSSGEQELFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNLGHVNIGAIQEPLAFILPKRETLFTLDDQALGPELTAPAPEPPAEEPRLEPAGPACPEGGRAETQAEPPSVGP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COG8 component of oligomeric golgi complex 8 [ Homo sapiens ]
Official Symbol COG8
Synonyms COG8; component of oligomeric golgi complex 8; conserved oligomeric Golgi complex subunit 8; DOR1; FLJ22315; dependent on RIC1; COG complex subunit 8; conserved oligomeric golgi complex component 8; CDG2H
Gene ID 84342
mRNA Refseq NM_032382
Protein Refseq NP_115758
MIM 606979
UniProt ID Q96MW5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All COG8 Products

Required fields are marked with *

My Review for All COG8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon