Recombinant Human CEBPB Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CEBPB-6222H |
Product Overview : | CEBPB MS Standard C13 and N15-labeled recombinant protein (NP_005185) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions. |
Molecular Mass : | 35.9 kDa |
AA Sequence : | MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CEBPB CCAAT enhancer binding protein beta [ Homo sapiens (human) ] |
Official Symbol | CEBPB |
Synonyms | CEBPB; CCAAT/enhancer binding protein (C/EBP), beta; TCF5; CCAAT/enhancer-binding protein beta; C/EBP beta; CRP2; IL6DBP; interleukin 6 dependent DNA binding protein; LAP; liver enriched transcriptional activator protein; NFIL6; nuclear factor of interleukin 6; TCF-5; nuclear factor NF-IL6; transcription factor 5; interleukin 6-dependent DNA-binding protein; liver-enriched transcriptional activator protein; NF-IL6; C/EBP-beta; MGC32080; |
Gene ID | 1051 |
mRNA Refseq | NM_005194 |
Protein Refseq | NP_005185 |
MIM | 189965 |
UniProt ID | P17676 |
◆ Recombinant Proteins | ||
CEBPB-1249H | Recombinant Human CEBPB Protein (Met199-Cys345), N-His tagged | +Inquiry |
CEBPB-573H | Recombinant Human CEBPB Protein, His (Fc)-Avi-tagged | +Inquiry |
Cebpb-876M | Recombinant Mouse Cebpb Protein, MYC/DDK-tagged | +Inquiry |
CEBPB-0892H | Recombinant Human CEBPB Protein (Val259-Cys345), N-His tagged | +Inquiry |
Cebpb-736M | Recombinant Mouse Cebpb Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEBPB-7598HCL | Recombinant Human CEBPB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CEBPB Products
Required fields are marked with *
My Review for All CEBPB Products
Required fields are marked with *
0
Inquiry Basket