Recombinant Human CEBPB Protein, MYC/DDK-tagged
Cat.No. : | CEBPB-4893H |
Product Overview : | Recombinant Human CEBPB Protein is produced by HEK293T expression system. This protein is fused with a C-MYC/DDK tag at the C-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions. |
Form : | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 35.9 kDa |
AA Sequence : | MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at –80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | >50 ug/mL as determined by microplate BCA method |
Gene Name | CEBPB CCAAT/enhancer binding protein (C/EBP), beta [ Homo sapiens ] |
Official Symbol | CEBPB |
Synonyms | CEBPB; TCF5; C/EBP beta; CRP2; IL6DBP; NFIL6; TCF-5; NF-IL6; C/EBP-beta; MGC32080; |
Gene ID | 1051 |
mRNA Refseq | NM_005194 |
Protein Refseq | NP_005185 |
MIM | 189965 |
UniProt ID | P17676 |
◆ Recombinant Proteins | ||
CEBPB-0892H | Recombinant Human CEBPB Protein (Val259-Cys345), N-His tagged | +Inquiry |
CEBPB-983R | Recombinant Rat CEBPB Protein, His (Fc)-Avi-tagged | +Inquiry |
CEBPB-6805C | Recombinant Chicken CEBPB | +Inquiry |
CEBPB-3260M | Recombinant Mouse CEBPB Protein | +Inquiry |
CEBPB-1249H | Recombinant Human CEBPB Protein (Met199-Cys345), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEBPB-7598HCL | Recombinant Human CEBPB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CEBPB Products
Required fields are marked with *
My Review for All CEBPB Products
Required fields are marked with *
0
Inquiry Basket