Description :	This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions.
Source :	HEK293T
Species :	Human
Tag :	Myc&DDK
Form :	25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass :	35.9 kDa
AA Sequence :	MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC
Purity :	> 80% as determined by SDS-PAGE and Coomassie blue staining
Stability :	Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage :	Store at –80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration :	>50 ug/mL as determined by microplate BCA method

Gene Name	CEBPB CCAAT/enhancer binding protein (C/EBP), beta [ Homo sapiens ]
Official Symbol	CEBPB
Synonyms	CEBPB; TCF5; C/EBP beta; CRP2; IL6DBP; NFIL6; TCF-5; NF-IL6; C/EBP-beta; MGC32080;
Gene ID	1051
mRNA Refseq	NM_005194
Protein Refseq	NP_005185
MIM	189965
UniProt ID	P17676

COA

Required fields are marked with *

Required fields are marked with *

Overall Rating *

Cat NO.

Review

Your Name

Phone Number

E-mail Address

Cat.No. :	CEBPB-4893H
Product Overview :	Recombinant Human CEBPB Protein is produced by HEK293T expression system. This protein is fused with a C-MYC/DDK tag at the C-terminal.

Recombinant Human CEBPB Protein, MYC/DDK-tagged