Recombinant Full Length Human CEBPB Protein, C-Flag-tagged
| Cat.No. : | CEBPB-543HFL |
| Product Overview : | Recombinant Full Length Human CEBPB Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions. |
| Source : | Mammalian cells |
| Species : | Human |
| Tag : | Flag |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 35.9 kDa |
| AA Sequence : | MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHE RAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYV SLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAY LGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRER NNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
| Full Length : | Full L. |
| Gene Name | CEBPB CCAAT enhancer binding protein beta [ Homo sapiens (human) ] |
| Official Symbol | CEBPB |
| Synonyms | TCF5; IL6DBP; NF-IL6; C/EBP-beta |
| Gene ID | 1051 |
| mRNA Refseq | NM_005194.4 |
| Protein Refseq | NP_005185.2 |
| MIM | 189965 |
| UniProt ID | P17676 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CEBPB Products
Required fields are marked with *
My Review for All CEBPB Products
Required fields are marked with *
0
Inquiry Basket
