Recombinant Human CCL18 Protein

• Cat.No.: CCL18-11H
• Product Overview: Recombinant Human CCL18 Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Description: Macrophage inflammatory protein-4 (MIP-4), also called CCL18, is a chemokine expressed in the lymph nodes, lungs, placenta, and bone marrow. MIP-4 receptors include the chemokine receptor 8 (CCR8), the G protein-coupled receptor 30 (GPR30), and the phosphatidylinositol transfer protein membrane-associate 3 (PITPNM3). MIP-4 acts as a chemoattractant for naive T cells, CD4+ T cells, CD8+ T cells, and nonactivated lymphocytes. Further, MIP-4 promotes breast cancer metastasis and attenuates the activation of acute lymphocytic leukemia B cells.
• Bio-activity: No biological activity data is available at this time.
• AA Sequence: AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution:
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature

Gene Information

• Gene Name: CCL18 chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) [ Homo sapiens (human) ]
• Official Symbol: CCL18
• Synonyms: CCL18; chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated); SCYA18, small inducible cytokine subfamily A (Cys Cys), member 18, pulmonary and activation regulated; C-C motif chemokine 18; AMAC 1; CKb7; DC CK1; DCCK1; MIP 4; PARC; CC chemokine PARC; CC chemokine ligand 18; chemokine (C-C), dendritic; dendritic cell chemokine 1; small inducible cytokine A18; small-inducible cytokine A18; macrophage inflammatory protein 4; pulmonary and activation-regulated chemokine; alternative macrophage activation-associated CC chemokine 1; small inducible cytokine subfamily A (Cys-Cys), member 18, pulmonary and activation-regulated; AMAC1; MIP-4; AMAC-1; DC-CK1; SCYA18
• Gene ID: 6362
• mRNA Refseq: NM_002988
• Protein Refseq: NP_002979
• MIM: 603757
• UniProt ID: P55774