Recombinant Human CCL17 Protein, GST-Tagged

• Cat.No.: CCL17-0614H
• Product Overview: Human CCL17 partial ORF (NP_002978, 24 a.a. - 94 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes, but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. [provided by RefSeq, Sep 2014]
• Molecular Mass: 33.55 kDa
• AA Sequence: ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCL17 chemokine (C-C motif) ligand 17 [ Homo sapiens ]
• Official Symbol: CCL17
• Synonyms: CCL17; chemokine (C-C motif) ligand 17; SCYA17, small inducible cytokine subfamily A (Cys Cys), member 17; C-C motif chemokine 17; ABCD 2; TARC; CC chemokine TARC; T cell-directed CC chemokine; small-inducible cytokine A17; thymus and activation-regulated chemokine; small inducible cytokine subfamily A (Cys-Cys), member 17; ABCD-2; SCYA17; A-152E5.3; MGC138271; MGC138273
• Gene ID: 6361
• mRNA Refseq: NM_002987
• Protein Refseq: NP_002978
• MIM: 601520
• UniProt ID: Q92583