Recombinant Mouse Ccl17 protein
Cat.No. : | Ccl17-622M |
Product Overview : | Recombinant Mouse Ccl17 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 70 |
Description : | Murine CCL17 also known as TARC, Small-inducible cytokine A17, Thymus and activation-regulated chemokine and SCYA17, is encoded by the CCL17 gene located on the chromosome 8. Among CC chemokine family members, CCL17 has approximately 24 – 29 % amino acid sequence identity with RANTES, MIP-1α, MIP-1β, MCP-1, MCP-2, MCP-3 and I-309. CCL17 is a secreted protein and expressed by thymus cells constitutively and phytohemagglutinin-stimulated peripheral blood mononuclear cells transiently. It signals through the chemokine receptors CCR4 and CCR8 and displays chemotactic activity for T lymphocytes and some other leukocytes. CCL17 play an important role in skin diseases such as atopic dermatitis, bullous pemphigoid and mycosis fungoides.Recombinant CCL17 has been shown to be chemotactic for T cell lines but not monocytes or neutrophils. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 1.0-10 ng/ml. |
Molecular Mass : | Approximately 7.9 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids. |
AA Sequence : | ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP |
Endotoxin : | Less than 1 EU/µg of rMuTARC/CCL17 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Ccl17 |
Official Symbol | Ccl17 |
Synonyms | CCL17; chemokine (C-C motif) ligand 17; small inducible cytokine subfamily A17; Tarc; Abcd-2; Scya17; Scya17l; |
Gene ID | 20295 |
mRNA Refseq | NM_011332 |
Protein Refseq | NP_035462 |
UniProt ID | F6R5P4 |
◆ Recombinant Proteins | ||
CCL17-680R | Recombinant Rhesus monkey CCL17 Protein, His-tagged | +Inquiry |
CCL17-24H | Recombinant Human CCL17 protein | +Inquiry |
Ccl17-129M | Active Recombinant Mouse Ccl17 Protein | +Inquiry |
CCL17-8818C | Recombinant Cynomolgus CCL17, His tagged | +Inquiry |
CCL17-55H | Recombinant Human CCL17 Protein, Biotin-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL17-535MCL | Recombinant Mouse CCL17 cell lysate | +Inquiry |
CCL17-001CCL | Recombinant Cynomolgus CCL17 cell lysate | +Inquiry |
CCL17-588HCL | Recombinant Human CCL17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccl17 Products
Required fields are marked with *
My Review for All Ccl17 Products
Required fields are marked with *
0
Inquiry Basket