Active Recombinant Human CCL17 Protein (71 aa)

• Cat.No.: CCL17-055C
• Product Overview: Recombinant Human CCL17 Protein without tag was expressed in E. coli.

Specification

• Description: CCL17 is a novel CC chemokine recently identified using a signal sequence trap method. CCL17 cDNA encodes a highly basic 94 amino acid residue precursor protein with a 23 aa residue signal peptide that is cleaved to generate the 71 aa residue mature secreted protein. Among CC chemokine family members, CCL17 has approximately 24 - 29% amino acid sequence identity with RANTES, MIP-1α, MIP-1β, MCP-1, MCP-2, MCP-3 and I-309. The gene for human CCL17 has been mapped to chromosome 16q13 rather than chromosome 17 where the genes for many human CC chemokines are clustered. CCL17 is constitutively expressed in thymus, and at a lower level in lung, colon, and small intestine. CCL17 is also transiently expressed in stimulated peripheral blood mononuclear cells.
• Source: E. coli
• Species: Human
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract human T cells using a concentration range of 1.0-10.0 ng/mL, corresponding to a Specific Activity of ＞1 × 10^5 IU/mg.
• Molecular Mass: 8.0kDa, a single non-glycosylated polypeptide chain containing 71 amino acids.
• Protein length: 71
• AA Sequence: ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
• Endotoxin: Less than 1 EU/mg of rHuTARC/CCL17 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: CCL17 chemokine (C-C motif) ligand 17 [ Homo sapiens ]
• Official Symbol: CCL17
• Synonyms: CCL17; chemokine (C-C motif) ligand 17; SCYA17, small inducible cytokine subfamily A (Cys Cys), member 17; C-C motif chemokine 17; ABCD 2; TARC; CC chemokine TARC; T cell-directed CC chemokine; small-inducible cytokine A17; thymus and activation-regulated chemokine; small inducible cytokine subfamily A (Cys-Cys), member 17; ABCD-2; SCYA17; A-152E5.3; MGC138271; MGC138273
• Gene ID: 6361
• mRNA Refseq: NM_002987
• Protein Refseq: NP_002978
• MIM: 601520
• UniProt ID: Q92583