Recombinant Human CCL17

• Cat.No.: CCL17-30148TH
• Product Overview: Highly pure (>98%) recombinant human TARC.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes, but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells.
• Tissue specificity: Expressed at high levels in thymus and at low levels in the lung, colon and small intestine.
• Form: Lyophilised:Please reconstitute this product in 200ul water.
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: Human TARC is an 8.0 kDa protein containing 71 amino acid residues:ARGTNVGRECCLEYFKGAIPLRKLK TWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAV KYLQSLERS
• Sequence Similarities: Belongs to the intercrine beta (chemokine CC) family.

Gene Information

• Gene Name: CCL17 chemokine (C-C motif) ligand 17 [ Homo sapiens ]
• Official Symbol: CCL17
• Synonyms: CCL17; chemokine (C-C motif) ligand 17; SCYA17, small inducible cytokine subfamily A (Cys Cys), member 17; C-C motif chemokine 17; ABCD 2; TARC
• Gene ID: 6361
• mRNA Refseq: NM_002987
• Protein Refseq: NP_002978
• MIM: 601520
• Uniprot ID: Q92583
• Chromosome Location: 16q13
• Pathway: Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem
• Function: chemokine activity; receptor binding