Recombinant Human CAPN3 protein, His-tagged

Cat.No. : CAPN3-263H
Product Overview : Recombinant Human CAPN3 protein(NP_000061)(1-156 aa), fused with His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
ProteinLength : 1-156 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : MEICADELKKVLNTVVNKHKDLKTHGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name CAPN3 calpain 3, (p94) [ Homo sapiens ]
Official Symbol CAPN3
Synonyms CAPN3; calpain 3, (p94); LGMD2, LGMD2A; calpain-3; CANP3; nCL 1; p94; calpain L3; new calpain 1; calpain, large polypeptide L3; calcium-activated neutral proteinase 3; calpain p94, large [catalytic] subunit; muscle-specific calcium-activated neutral protease 3 large subunit; LGMD2; nCL-1; CANPL3; LGMD2A; MGC4403; MGC10767; MGC11121; MGC14344;
Gene ID 825
mRNA Refseq NM_000070
Protein Refseq NP_000061
MIM 114240
UniProt ID P20807

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CAPN3 Products

Required fields are marked with *

My Review for All CAPN3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon