Recombinant Human CAPN3 protein, His-tagged

• Cat.No.: CAPN3-263H
• Product Overview: Recombinant Human CAPN3 protein(NP_000061)(1-156 aa), fused with His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 1-156 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: MEICADELKKVLNTVVNKHKDLKTHGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: CAPN3 calpain 3, (p94) [ Homo sapiens ]
• Official Symbol: CAPN3
• Synonyms: CAPN3; calpain 3, (p94); LGMD2, LGMD2A; calpain-3; CANP3; nCL 1; p94; calpain L3; new calpain 1; calpain, large polypeptide L3; calcium-activated neutral proteinase 3; calpain p94, large [catalytic] subunit; muscle-specific calcium-activated neutral protease 3 large subunit; LGMD2; nCL-1; CANPL3; LGMD2A; MGC4403; MGC10767; MGC11121; MGC14344
• Gene ID: 825
• mRNA Refseq: NM_000070
• Protein Refseq: NP_000061
• MIM: 114240
• UniProt ID: P20807