Recombinant Human ASPA protein, His&Myc-tagged
Cat.No. : | ASPA-2202H |
Product Overview : | Recombinant Human ASPA protein(P45381)(1-313aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 1-313aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.7 kDa |
AA Sequence : | MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ASPA aspartoacylase [ Homo sapiens ] |
Official Symbol | ASPA |
Synonyms | ASPA; aspartoacylase; aspartoacylase (aminoacylase 2, Canavan disease); ACY2; aminoacylase 2; ASP; Canavan disease; ACY-2; aminoacylase-2; |
Gene ID | 443 |
mRNA Refseq | NM_000049 |
Protein Refseq | NP_000040 |
MIM | 608034 |
UniProt ID | P45381 |
◆ Recombinant Proteins | ||
ASPA-2438H | Recombinant Human ASPA Protein (1-313 aa), His-Myc-tagged | +Inquiry |
Aspa-253M | Recombinant Mouse Aspa Protein, His-tagged | +Inquiry |
ASPA-163H | Recombinant Human ASPA protein, MYC/DDK-tagged | +Inquiry |
ASPA-1936H | Recombinant Human ASPA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ASPA-2202H | Recombinant Human ASPA protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASPA-8647HCL | Recombinant Human ASPA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ASPA Products
Required fields are marked with *
My Review for All ASPA Products
Required fields are marked with *
0
Inquiry Basket