Recombinant Human ASPA Protein (1-313 aa), His-Myc-tagged
Cat.No. : | ASPA-2438H |
Product Overview : | Recombinant Human ASPA Protein (1-313 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His&Myc |
Protein Length : | 1-313 aa |
Description : | Catalyzes the deacetylation of N-acetylaspartic acid (NAA) to produce acetate and L-aspartate. NAA occurs in high concentration in brain and its hydrolysis NAA plays a significant part in the maintenance of intact white matter. In other tissues it act as a scavenger of NAA from body fluids. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 39.7 kDa |
AA Sequence : | MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | ASPA aspartoacylase [ Homo sapiens ] |
Official Symbol | ASPA |
Synonyms | ASPA; aspartoacylase; ACY2; aminoacylase 2; ASP; Canavan disease; ACY-2; aminoacylase-2; |
Gene ID | 443 |
mRNA Refseq | NM_000049 |
Protein Refseq | NP_000040 |
MIM | 608034 |
UniProt ID | P45381 |
◆ Recombinant Proteins | ||
ASPA-252H | Recombinant Human ASPA Protein, His-tagged | +Inquiry |
ASPA-4991H | Recombinant Human ASPA protein, His&Myc-tagged | +Inquiry |
ASPA-259R | Recombinant Rhesus Macaque ASPA Protein, His (Fc)-Avi-tagged | +Inquiry |
Aspa-531M | Recombinant Mouse Aspa Protein, MYC/DDK-tagged | +Inquiry |
ASPA-163H | Recombinant Human ASPA protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASPA-8647HCL | Recombinant Human ASPA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ASPA Products
Required fields are marked with *
My Review for All ASPA Products
Required fields are marked with *
0
Inquiry Basket