Recombinant Human ASGR1, His-tagged

• Cat.No.: ASGR1-26517TH
• Product Overview: Recombinant fragment, corresponding to amino acids 55-291 of Human Asialoglycoprotein Receptor 1 with an N terminal His tag; MWt 32kDa.

Specification

• Description: This gene encodes a subunit of the asialoglycoprotein receptor. This receptor is a transmembrane protein that plays a critical role in serum glycoprotein homeostasis by mediating the endocytosis and lysosomal degradation of glycoproteins with exposed terminal galactose or N-acetylgalactosamine residues. The asialoglycoprotein receptor may facilitate hepatic infection by multiple viruses including hepatitis B, and is also a target for liver-specific drug delivery. The asialoglycoprotein receptor is a hetero-oligomeric protein composed of major and minor subunits, which are encoded by different genes. The protein encoded by this gene is the more abundant major subunit. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 88 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VVCVIGSQNSQLQEELRGLRETFSNFTASTEAQVKGLSTQ GGNVGRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVS DLRSLSCQMAALQGNGSERTCCPVNWVEHERSCYWFSR SGKAWADADNYCRLEDAHLVVVTSWEEQKFVQHHIGPV NTWMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHG LGGGEDCAHFTDDGRWNDDVCQRPYRWVCETELDKASQ EPPLL
• Protein length: 55-291 a.a.

Gene Information

• Gene Name: ASGR1 asialoglycoprotein receptor 1 [ Homo sapiens ]
• Official Symbol: ASGR1
• Synonyms: ASGR1; asialoglycoprotein receptor 1; CLEC4H1
• Gene ID: 432
• mRNA Refseq: NM_001197216
• Protein Refseq: NP_001184145
• MIM: 108360
• Uniprot ID: P07306
• Chromosome Location: 17p13-p11
• Function: asialoglycoprotein receptor activity; metal ion binding; protein binding; protein homodimerization activity; receptor activity