Recombinant Rat Asgr1 protein, His&Myc-tagged

• Cat.No.: Asgr1-928R
• Product Overview: Recombinant Rat Asgr1 protein(P02706)(61-284aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cells.

Specification

• Species: Rat
• Source: Insect Cells
• Tag: His&Myc
• ProteinLength: 61-284aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 29.9 kDa
• AA Sequence: QNSQLREDLRVLRQNFSNFTVSTEDQVKALTTQGERVGRKMKLVESQLEKHQEDLREDHSRLLLHVKQLVSDVRSLSCQMAALRGNGSERICCPINWVEYEGSCYWFSSSVKPWTEADKYCQLENAHLVVVTSWEEQRFVQQHMGPLNTWIGLTDQNGPWKWVDGTDYETGFKNWRPGQPDDWYGHGLGGGEDCAHFTTDGHWNDDVCRRPYRWVCETELGKAN
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: Asgr1 asialoglycoprotein receptor 1 [ Rattus norvegicus ]
• Official Symbol: Asgr1
• Synonyms: ASGR1; asialoglycoprotein receptor 1; HL-1; RHL-1; ASGPR 1; ASGP-R 1; hepatic lectin 1 RHL1; hepatic lectin 1, RHL1; asialoglycoprotein receptor (RHL1); Asialoglycoprotein receptor 1 (hepatic lectin); ASGR; RHL1; RATRHL1
• Gene ID: 24210
• mRNA Refseq: NM_012503
• Protein Refseq: NP_036635