Recombinant Mouse Asgr1 protein, GST-tagged

• Cat.No.: Asgr1-2556M
• Product Overview: Recombinant Mouse Asgr1 protein(P34927)(61-284aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: GST
• Protein Length: 61-284aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 52.8 kDa
• AA Sequence: QNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Asgr1 asialoglycoprotein receptor 1 [ Mus musculus ]
• Official Symbol: Asgr1
• Synonyms: ASGR1; asialoglycoprotein receptor 1; HL-1; mHL-1; ASGPR 1; ASGP-R 1; hepatic lectin 1; Asgr; ASGPR1; Asgr-1
• Gene ID: 11889
• mRNA Refseq: NM_009714
• Protein Refseq: NP_033844