Recombinant Human AMELX protein, His-tagged
Cat.No. : | AMELX-12H |
Product Overview : | Recombinant Human AMELX(Met17-Asp191) fused with His tag at N-terminal was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Amelogenin is the name for a series of closely related proteins involved in amelogenesis, the development of enamel. They are a type of extracellular matrix (ECM) protein, which, together with ameloblastins, enamelins, and tuftelins direct the mineralization of enamel to form a highly organized matrix of rods, interrod crystal, and protein. Amelogenins are believed to be involved in the organizing of enamel rods during tooth development. These proteins regulate the initiation and growth of hydroxyapatite crystals during the mineralization of enamel. In addition, amelogenins appear to aid in the development of cementum by directing cementoblasts to the tooth's root surface. |
Source : | Yeast |
Species : | Human |
Tag : | His |
Form : | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. |
AA Sequence : | MGHHHHHHGSGSLEVLFQGPMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWL HHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQP YQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Protein length : | 17-191 a.a. |
Gene Name | AMELX amelogenin, X-linked [ Homo sapiens ] |
Official Symbol | AMELX |
Synonyms | AMELX; amelogenin, X-linked; AMG; AI1E; AIH1; ALGN; AMGL; AMGX; |
Gene ID | 265 |
mRNA Refseq | NM_001142 |
Protein Refseq | NP_001133 |
MIM | 300391 |
UniProt ID | Q99217 |
Chromosome Location | Xp22.31-p22.1 |
Function | cell surface binding; growth factor activity; hydroxyapatite binding; identical protein binding; protein binding; structural constituent of tooth enamel; structural constituent of tooth enamel; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All AMELX Products
Required fields are marked with *
My Review for All AMELX Products
Required fields are marked with *
0
Inquiry Basket