Recombinant Human AMELX protein, GST-tagged

• Cat.No.: AMELX-519H
• Product Overview: Human AMELX full-length ORF ( NP_001133.1, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in this gene cause X-linked amelogenesis imperfecta. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 48 kDa
• AA Sequence: MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AMELX amelogenin, X-linked [ Homo sapiens ]
• Official Symbol: AMELX
• Synonyms: AMELX; amelogenin, X-linked; AIH1, amelogenin (X chromosome, amelogenesis imperfecta 1) , AMG; amelogenin, X isoform; amelogenesis imperfecta 1; amelogenin (amelogenesis imperfecta 1, X-linked); amelogenin (X chromosome, amelogenesis imperfecta 1); AMG; AI1E; AIH1; ALGN; AMGL; AMGX
• Gene ID: 265
• mRNA Refseq: NM_001142
• Protein Refseq: NP_001133
• MIM: 300391
• UniProt ID: Q99217