Recombinant Human AMELX, His&SUMO-tagged
Cat.No. : | AMELX-7078H |
Product Overview : | Recombinant Human AMELX(NP_001133.1)(17-191aa), fused to two N-terminal tag, His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 17-191aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.9kDa |
AA Sequence : | MPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AMELX amelogenin X-linked [ Homo sapiens (human) ] |
Official Symbol | AMELX |
Synonyms | AMG; AI1E; AIH1; ALGN; AMGL; AMGX |
Gene ID | 265 |
mRNA Refseq | NM_001142.2 |
Protein Refseq | NP_001133.1 |
MIM | 300391 |
UniProt ID | Q99217 |
◆ Recombinant Proteins | ||
AMELX-7079H | Recombinant Human AMELX, His-tagged | +Inquiry |
AMELX-305R | Recombinant Rat AMELX Protein, His (Fc)-Avi-tagged | +Inquiry |
AMELX-7077H | Recombinant Human AMELX, His-tagged | +Inquiry |
AMELX-015H | Recombinant Human AMELX Protein, (AFPn)-His-TEV-tagged | +Inquiry |
AMELX-12H | Recombinant Human AMELX protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMELX-70HCL | Recombinant Human AMELX cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AMELX Products
Required fields are marked with *
My Review for All AMELX Products
Required fields are marked with *
0
Inquiry Basket