Recombinant Human AGR2, His-tagged
Cat.No. : | AGR2-63H |
Product Overview : | Recombinant Human Anterior Gradient Homolog 2 fused to His-tag on N-terminal produced inE.Coliis a single, non-glycosylated polypeptide chain containing 192 amino acids (21-175) & having a molecular mass of 22 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | AGR2 (Anterior gradient 2 homolog) is the human orthologue of the secreted Xenopus laevis Anterior Gradient protein (XAG-2). This is a small, possibly secreted molecule of yet weakly defined functions that is widely expressed in human tissues. Expression of AGR2 shows a positive correlation with expression of estrogen receptor in breast carcinoma and a negative correlation with expression of EGF receptor. |
Sequence : | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMRDTTVKPGAKKDKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQAL KKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQ YVPRIMFVDPSLTVRADITGRYSNRLYAYE PADTALLLDNMKKALKLLKTEL |
Physical Appearance : | Sterile filtered clorless solution. |
Purity : | Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
Formulation : | The protein (1mg/ml) contains 1X PBS pH-7.4 |
Applications : | • ELISA • MS • Inhibition Assays • Western Blotting |
Storage : | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles |
Gene Name | anterior gradient homolog 2 (Xenopus laevis) [ Homo sapiens ] |
Synonyms | AG2; GOB-4; HAG-2; XAG-2; PDIA17; AGR2; anterior gradient 2 homolog; secreted cement gland homolog; protein disulfide isomerase family A, member 17; Anterior gradient protein 2 homolog; hAG-2; AG-2; Secreted cement gland protein XAG-2 homolog; HPC8; UNQ515/PRO1030 |
Gene ID | 10551 |
mRNA Refseq | NM_006408 |
Protein Refseq | NP_006399 |
MIM | 606358 |
UniProt ID | O95994 |
Chromosome Location | 7p21.3 |
Function | protein binding |
◆ Recombinant Proteins | ||
Agr2-1099M | Recombinant Mouse Agr2 protein, His&Myc-tagged | +Inquiry |
AGR2-26141TH | Recombinant Human AGR2, His-tagged | +Inquiry |
Agr2-502R | Recombinant Rat Agr2 Protein, His-tagged | +Inquiry |
AGR2-0168H | Recombinant Human AGR2 Protein (Arg21-Leu175), C-His-tagged | +Inquiry |
AGR2-441H | Recombinant Human AGR2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGR2-8972HCL | Recombinant Human AGR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AGR2 Products
Required fields are marked with *
My Review for All AGR2 Products
Required fields are marked with *
0
Inquiry Basket