Recombinant Human AGR2 protein, GST-tagged
Cat.No. : | AGR2-1522H |
Product Overview : | Recombinant Human AGR2 protein(17-175 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | GST |
Protein Length : | 17-175 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | YTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL |
Gene Name | AGR2 anterior gradient 2 homolog (Xenopus laevis) [ Homo sapiens ] |
Official Symbol | AGR2 |
Synonyms | AGR2; anterior gradient 2 homolog (Xenopus laevis); anterior gradient protein 2 homolog; AG2; HAG 2; PDIA17; protein disulfide isomerase family A; member 17; XAG 2; AG-2; HPC8; anterior gradient homolog 2; secreted cement gland homolog; secreted cement gland protein XAG-2 homolog; protein disulfide isomerase family A, member 17; GOB-4; HAG-2; XAG-2; |
Gene ID | 10551 |
mRNA Refseq | NM_006408 |
Protein Refseq | NP_006399 |
MIM | 606358 |
UniProt ID | O95994 |
◆ Recombinant Proteins | ||
GSDMD-3957M | Recombinant Mouse GSDMD Protein, His (Fc)-Avi-tagged | +Inquiry |
Gsdmd-1601R | Recombinant Rat Gsdmd Protein, His-tagged | +Inquiry |
AGRP-2464H | Recombinant Human AGRP protein, His-tagged | +Inquiry |
GSDMD-7312M | Recombinant Mouse GSDMD Protein | +Inquiry |
GSDMD-643H | Recombinant Human GSDMD protein, MBP&His-Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSDMD-5725HCL | Recombinant Human GSDMD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gsdmd Products
Required fields are marked with *
My Review for All Gsdmd Products
Required fields are marked with *
0
Inquiry Basket