Recombinant Human AGR2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | AGR2-3191H |
Product Overview : | AGR2 MS Standard C13 and N15-labeled recombinant protein (NP_006399) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and a C-terminal ER-retention sequence. This protein plays a role in cell migration, cellular transformation and metastasis and is as a p53 inhibitor. As an ER-localized molecular chaperone, it plays a role in the folding, trafficking, and assembly of cysteine-rich transmembrane receptors and the cysteine-rich intestinal gylcoprotein mucin. This gene has been implicated in inflammatory bowel disease and cancer progression. |
Molecular Mass : | 19.8 kDa |
AA Sequence : | MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | AGR2 anterior gradient 2, protein disulphide isomerase family member [ Homo sapiens (human) ] |
Official Symbol | AGR2 |
Synonyms | AGR2; anterior gradient 2 homolog (Xenopus laevis); anterior gradient protein 2 homolog; AG2; HAG 2; PDIA17; protein disulfide isomerase family A; member 17; XAG 2; AG-2; HPC8; anterior gradient homolog 2; secreted cement gland homolog; secreted cement gland protein XAG-2 homolog; protein disulfide isomerase family A, member 17; GOB-4; HAG-2; XAG-2; |
Gene ID | 10551 |
mRNA Refseq | NM_006408 |
Protein Refseq | NP_006399 |
MIM | 606358 |
UniProt ID | O95994 |
◆ Recombinant Proteins | ||
AGR2-936HF | Recombinant Full Length Human AGR2 Protein, GST-tagged | +Inquiry |
AGR2-441H | Recombinant Human AGR2 Protein, GST-tagged | +Inquiry |
AGR2-273R | Recombinant Rhesus monkey AGR2 Protein, His-tagged | +Inquiry |
AGR2-936HFL | Recombinant Full Length Human AGR2 Protein, C-Flag-tagged | +Inquiry |
AGR2-63H | Recombinant Human AGR2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGR2-8972HCL | Recombinant Human AGR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AGR2 Products
Required fields are marked with *
My Review for All AGR2 Products
Required fields are marked with *
0
Inquiry Basket