Recombinant Human AGPAT3 Protein, GST-tagged
Cat.No. : | AGPAT3-431H |
Product Overview : | Human AGPAT3 partial ORF ( NP_064517, 155 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is an acyltransferase that converts lysophosphatidic acid into phosphatidic acid, which is the second step in the de novo phospholipid biosynthetic pathway. The encoded protein may be an integral membrane protein. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 37.29 kDa |
AA Sequence : | VVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLPVLKYHLLPRTKGFTTAVKCLRGTVAAVYDVTLNFRGNKNPSLLGILYGKKYEADMCVRRFP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AGPAT3 1-acylglycerol-3-phosphate O-acyltransferase 3 [ Homo sapiens ] |
Official Symbol | AGPAT3 |
Synonyms | AGPAT3; 1-acylglycerol-3-phosphate O-acyltransferase 3; 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma; LPAAT gamma; 1-AGPAT 3; 1-AGP acyltransferase 3; lysophosphatidic acid acyltransferase gamma; lysophosphatidic acid acyltransferase-gamma1; LPAAT-GAMMA1; MGC4604; |
Gene ID | 56894 |
mRNA Refseq | NM_001037553 |
Protein Refseq | NP_001032642 |
MIM | 614796 |
UniProt ID | Q9NRZ7 |
◆ Cell & Tissue Lysates | ||
AGPAT3-8976HCL | Recombinant Human AGPAT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AGPAT3 Products
Required fields are marked with *
My Review for All AGPAT3 Products
Required fields are marked with *
0
Inquiry Basket