Recombinant Full Length Human 1-Acyl-Sn-Glycerol-3-Phosphate Acyltransferase Gamma(Agpat3) Protein, His-Tagged
Cat.No. : | RFL28489HF |
Product Overview : | Recombinant Full Length Human 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma(AGPAT3) Protein (Q9NRZ7) (1-376aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-376) |
Form : | Lyophilized powder |
AA Sequence : | MGLLAFLKTQFVLHLLVGFVFVVSGLVINFVQLCTLALWPVSKQLYRRLNCRLAYSLWSQ LVMLLEWWSCTECTLFTDQATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKV LAKKELLYVPLIGWTWYFLEIVFCKRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRF TETKHRVSMEVAAAKGLPVLKYHLLPRTKGFTTAVKCLRGTVAAVYDVTLNFRGNKNPSL LGILYGKKYEADMCVRRFPLEDIPLDEKEAAQWLHKLYQEKDALQEIYNQKGMFPGEQFK PARRPWTLLNFLSWATILLSPLFSFVLGVFASGSPLLILTFLGFVGAASFGVRRLIGVTE IEKGSSYGNQEFKKKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AGPAT3 |
Synonyms | AGPAT3; LPAAT3; UNQ759/PRO1490; 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma; 1-acylglycerol-3-phosphate O-acyltransferase 3; 1-AGP acyltransferase 3; 1-AGPAT 3; Lysophosphatidic acid acyltransferase gamma; LPAAT-gamma |
UniProt ID | Q9NRZ7 |
◆ Recombinant Proteins | ||
TMUB1-4856R | Recombinant Rhesus monkey TMUB1 Protein, His-tagged | +Inquiry |
CCL13-2792H | Recombinant Human Chemokine (C-C Motif) Ligand 13, His-tagged | +Inquiry |
IL1A-3095H | Recombinant Human IL1A protein, His-tagged | +Inquiry |
PCID2-12494M | Recombinant Mouse PCID2 Protein | +Inquiry |
SE1693-2793S | Recombinant Staphylococcus epidermidis ATCC 12228 SE1693 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CTSB-26408TH | Native Human CTSB | +Inquiry |
B2M-8046H | Native Human Beta 2 MicroGlobulin | +Inquiry |
DAO1-25P | Active Native Porcine D-Amino acid oxidase | +Inquiry |
AGP-001B | Native Bovine AGP Protein | +Inquiry |
Prothrombin-92M | Native Mouse Prothrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLIPR1-2392HCL | Recombinant Human GLIPR1 cell lysate | +Inquiry |
GPT-721RCL | Recombinant Rat GPT cell lysate | +Inquiry |
MET-2047MCL | Recombinant Mouse MET cell lysate | +Inquiry |
RUNDC3A-2113HCL | Recombinant Human RUNDC3A 293 Cell Lysate | +Inquiry |
ANXA11-8837HCL | Recombinant Human ANXA11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AGPAT3 Products
Required fields are marked with *
My Review for All AGPAT3 Products
Required fields are marked with *
0
Inquiry Basket