Recombinant Full Length Pongo Abelii 1-Acyl-Sn-Glycerol-3-Phosphate Acyltransferase Gamma(Agpat3) Protein, His-Tagged
Cat.No. : | RFL27810PF |
Product Overview : | Recombinant Full Length Pongo abelii 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma(AGPAT3) Protein (Q5RA57) (1-376aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Abelii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-376) |
Form : | Lyophilized powder |
AA Sequence : | MGLLAFLKTQFVLHPLVGFVFVVSGLVINFVQLCTLALWPVSKQLYRRLNCRLAYSLWSQ LVMLLEWWSCTECTLFTDQATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKV LAKKELLYVPLIGWTWYFLEIVFCKRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRF TETKHRVSMEVAAAKGLPVLKYHLLPRTKGFTTAVKCLRGTVAAVYDVTLNFRGNKNPSL LGILYGKKYEADMCVRRFPLEDIPLDEKEAAQWLHKLYQEKDALQEIYNQKGMFPGEQFK PARRPWTLLNFLSWATILLSPLFSFVLGVFASGSPLLILTFLGFVGAASFGVRRLIGVTE IEKGSSYGNQEFKKKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AGPAT3 |
Synonyms | AGPAT3; 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma; 1-acylglycerol-3-phosphate O-acyltransferase 3; 1-AGP acyltransferase 3; 1-AGPAT 3; Lysophosphatidic acid acyltransferase gamma; LPAAT-gamma |
UniProt ID | Q5RA57 |
◆ Native Proteins | ||
Lectin-1798L | Active Native Lotus Tetragonolobus Lectin Protein, Fluorescein labeled | +Inquiry |
CKMB-256H | Active Native Human CKMB protein | +Inquiry |
GH1-8147H | Native Growth Hormone (GH) | +Inquiry |
RWX-308S | Native Snake RVV-X ACTIVATOR | +Inquiry |
Lectin-1781G | Active Native Griffonia Simplicifolia Lectin I Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYSTM1-8015HCL | Recombinant Human C5orf32 293 Cell Lysate | +Inquiry |
ZNF48-2050HCL | Recombinant Human ZNF48 cell lysate | +Inquiry |
CTSE-2190MCL | Recombinant Mouse CTSE cell lysate | +Inquiry |
APOBEC3G-8784HCL | Recombinant Human APOBEC3G 293 Cell Lysate | +Inquiry |
DLD-6912HCL | Recombinant Human DLD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AGPAT3 Products
Required fields are marked with *
My Review for All AGPAT3 Products
Required fields are marked with *
0
Inquiry Basket