Recombinant Human ADIPOQ Protein

• Cat.No.: ADIPOQ-03H
• Product Overview: Recombinant human ADIPOQ (15-244, 231aa) without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 15-244
• Description: This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in this gene are associated with adiponectin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified.
• Form: Liquid
• Molecular Mass: 25.1 kDa
• AA Sequence: MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by Bradford assay)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 1 mM DTT.

Gene Information

• Gene Name: ADIPOQ adiponectin, C1Q and collagen domain containing [ Homo sapiens (human) ]
• Official Symbol: ADIPOQ
• Synonyms: ADIPOQ; adiponectin, C1Q and collagen domain containing; ACDC; ADPN; APM1; APM-1; GBP28; ACRP30; ADIPQTL1; adiponectin; 30 kDa adipocyte complement-related protein; adipocyte complement-related 30 kDa protein; adipose most abundant gene transcript 1 protein; adipose specific collagen-like factor; gelatin-binding protein 28
• Gene ID: 9370
• mRNA Refseq: NM_004797
• Protein Refseq: NP_004788
• MIM: 605441
• UniProt ID: Q15848