Active Recombinant Mouse Adipoq Protein

• Cat.No.: Adipoq-7152M
• Product Overview: Recombinant mouse Adipoq protein without tag was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Description: Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.
• Form: Lyophilized (0.4 μm filtered) purified protein
• Bio-activity: Full-length adiponectin has been shown to activate AMP-activated protein kinase in hepatocyte. It can also activate AMPK in HepG2 human hepatocytes at the concentration of as low as 1.0 μg/mL. In vitro gluconeogenesis assay in primary rat hepatocytes was performed, showing the murine adiponectin derived from mammalian cells can inhibit glucose production.
• AA Sequence: EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTNDYKDDDDK
• Purity: > 98 % as determined by densitometric image analysis
• Applications: ELISA; WB; Cell culture and/or animal studies.
• Stability: Shelf life: one year from despatch.
• Storage: Store lyophilized (preferably in a desiccator) at -20 centigrade and in aliquots at -80 centigrade.
  Reconstituted antibody can be stored at 4 centigrade for a limited period of time; it does not show decline in activity after two weeks at 4 centigrade.
  Avoid repeated freezing and thawing.
• Concentration: 0.5 mg/mL
• Storage Buffer: 0.05 M Phosphate buffer, 0.075 M NaCl, pH 7.4
• Reconstitution: Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely.

Gene Information

• Gene Name: Adipoq adiponectin, C1Q and collagen domain containing [ Mus musculus (house mouse) ]
• Official Symbol: Adipoq
• Synonyms: Adipoq; adiponectin, C1Q and collagen domain containing; a; Ad; ap; APN; Acd; Acr; Acdc; Adid; GBP2; adip; apM1; 30kDa; GBP28; adipo; Acrp30; adiponectin; 30 kDa adipocyte complement-related protein; adipocyte complement related protein; adipocyte complement-related 30 kDa protein; adipocyte, C1Q and collagen domain containing; adipocyte, C1q and collagen domain-containing protein; adipocyte-specific protein AdipoQ; adiponectin d
• Gene ID: 11450
• mRNA Refseq: NM_009605
• Protein Refseq: NP_033735
• UniProt ID: Q60994