Recombinant Mouse Adipoq Protein

• Cat.No.: Adipoq-7149M
• Product Overview: Recombinant mouse globular domain of adiponectin/acrp30 (amino acid residues, 111-247, gAcrp30) protein without tag was overexpressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 111-247
• Description: Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.
• Form: Liquid
• Molecular Mass: 16 kDa
• AA Sequence: MAYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
• Purity: > 95 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store (in aliquots) at -20 centigrade. Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL
• Storage Buffer: 20 mM Tris-HCl pH 7.5, 50 mM NaCl, 5 mM DTT, 10 % Glycerol

Gene Information

• Gene Name: Adipoq adiponectin, C1Q and collagen domain containing [ Mus musculus (house mouse) ]
• Official Symbol: Adipoq
• Synonyms: Adipoq; adiponectin, C1Q and collagen domain containing; a; Ad; ap; APN; Acd; Acr; Acdc; Adid; GBP2; adip; apM1; 30kDa; GBP28; adipo; Acrp30; adiponectin; 30 kDa adipocyte complement-related protein; adipocyte complement related protein; adipocyte complement-related 30 kDa protein; adipocyte, C1Q and collagen domain containing; adipocyte, C1q and collagen domain-containing protein; adipocyte-specific protein AdipoQ; adiponectin d
• Gene ID: 11450
• mRNA Refseq: NM_009605
• Protein Refseq: NP_033735
• UniProt ID: Q60994