Recombinant Human ADAMTS18 Protein, GST-tagged

• Cat.No.: ADAMTS18-303H
• Product Overview: Human ADAMTS18 partial ORF ( NP_955387.1, 942 a.a. - 1047 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature protein, which may regulate hemostatic balance and function as a tumor suppressor. Mutations in this gene may be associated with microcornea, myopic chorioretinal atrophy, and telecanthus (MMCAT) and cone-rod dystrophy in human patients. [provided by RefSeq, May 2016]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.4 kDa
• AA Sequence: TCSKACAGGQQSRKIQCVQKKPFQKEEAVLHSLCPVSTPTQVQACNSHACPPQWSLGPWSQCSKTCGRGVRKRELLCKGSAAETLPESQCTSLPRPELQEGCVLGR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADAMTS18 ADAM metallopeptidase with thrombospondin type 1 motif, 18 [ Homo sapiens ]
• Official Symbol: ADAMTS18
• Synonyms: ADAMTS18; ADAM metallopeptidase with thrombospondin type 1 motif, 18; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 18 , ADAMTS21; A disintegrin and metalloproteinase with thrombospondin motifs 18; disintegrin and metalloprotease-like protein; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 18; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 21; KNO2; ADAMTS21
• Gene ID: 170692
• mRNA Refseq: NM_199355
• Protein Refseq: NP_955387
• MIM: 607512
• UniProt ID: Q8TE60