Recombinant Human ADAMTS18 protein, GST-tagged

Cat.No. : ADAMTS18-26H
Product Overview : Recombinant Human ADAMTS18(892 - 1060 aa) fused with GST tag was expressed in E. coli.
Availability April 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 892-1060 a.a.
Description : This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature protein, which may regulate hemostatic balance and function as a tumor suppressor. Mutations in this gene may be associated with microcornea, myopic chorioretinal atrophy, and telecanthus (MMCAT) and cone-rod dystrophy in human patients.
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). Normally 5 % - 8 % trehalose and mannitol are added as protectants before lyophilization.
AA Sequence : GYINVKAICLRDQNTQVNSSFCSAKTKPVTEPKICNAFSCPAYWMPGEWSTCSKACAGGQQSRKIQCVQKKPFQKEEAVLHSLCPVSTPTQVQACNSHACPPQWSLGPWSQCSKTCGRGVRKRELLCKGSAAETLPESQCTSLPRPELQEGCVLGRCPKNSRLQWVASS
Purity : 75%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Stability and Storage:
Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.
Storage of Reconstituted Protein:
Short-term storage: Store at 2-8 centigrade for two weeks.
Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name ADAMTS18 ADAM metallopeptidase with thrombospondin type 1 motif, 18 [ Homo sapiens ]
Official Symbol ADAMTS18
Synonyms ADAMTS18; ADAM metallopeptidase with thrombospondin type 1 motif, 18; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 18 , ADAMTS21; A disintegrin and metalloproteinase with thrombospondin motifs 18; disintegrin and metalloprotease-like protein; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 18; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 21; KNO2; ADAMTS21;
Gene ID 170692
mRNA Refseq NM_199355
Protein Refseq NP_955387
MIM 607512
UniProt ID Q8TE60
Chromosome Location 16q23
Function metal ion binding; metalloendopeptidase activity; peptidase activity; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ADAMTS18 Products

Required fields are marked with *

My Review for All ADAMTS18 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon