Recombinant Human ADAMTS18 protein, GST-tagged

• Cat.No.: ADAMTS18-26H
• Product Overview: Recombinant Human ADAMTS18(892 - 1060 aa) fused with GST tag was expressed in E. coli.

Specification

• Description: This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature protein, which may regulate hemostatic balance and function as a tumor suppressor. Mutations in this gene may be associated with microcornea, myopic chorioretinal atrophy, and telecanthus (MMCAT) and cone-rod dystrophy in human patients.
• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). Normally 5 % - 8 % trehalose and mannitol are added as protectants before lyophilization.
• AA Sequence: GYINVKAICLRDQNTQVNSSFCSAKTKPVTEPKICNAFSCPAYWMPGEWSTCSKACAGGQQSRKIQCVQKKPFQKEEAVLHSLCPVSTPTQVQACNSHACPPQWSLGPWSQCSKTCGRGVRKRELLCKGSAAETLPESQCTSLPRPELQEGCVLGRCPKNSRLQWVASS
• Purity: 75%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Stability and Storage:
  Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.
  Storage of Reconstituted Protein:
  Short-term storage: Store at 2-8 centigrade for two weeks.
  Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
  If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
  Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
• Protein length: 892-1060 a.a.

Gene Information

• Gene Name: ADAMTS18 ADAM metallopeptidase with thrombospondin type 1 motif, 18 [ Homo sapiens ]
• Official Symbol: ADAMTS18
• Synonyms: ADAMTS18; ADAM metallopeptidase with thrombospondin type 1 motif, 18; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 18 , ADAMTS21; A disintegrin and metalloproteinase with thrombospondin motifs 18; disintegrin and metalloprotease-like protein; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 18; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 21; KNO2; ADAMTS21
• Gene ID: 170692
• mRNA Refseq: NM_199355
• Protein Refseq: NP_955387
• MIM: 607512
• UniProt ID: Q8TE60
• Chromosome Location: 16q23
• Function: metal ion binding; metalloendopeptidase activity; peptidase activity; zinc ion binding