Recombinant Human ADAMTS18 protein(913-1040aa), His-GST&Myc-tagged

• Cat.No.: ADAMTS18-4326H
• Product Overview: Recombinant Human ADAMTS18 protein(Q8TE60)(913-1040aa), fused with N-terminal His and GST tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: N-His-GST&C-Myc
• Protein length: 913-1040aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 49.1 kDa
• AASequence: CSAKTKPVTEPKICNAFSCPAYWMPGEWSTCSKACAGGQQSRKIQCVQKKPFQKEEAVLHSLCPVSTPTQVQACNSHACPPQWSLGPWSQCSKTCGRGVRKRELLCKGSAAETLPESQCTSLPRPELQ
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: ADAMTS18 ADAM metallopeptidase with thrombospondin type 1 motif, 18 [ Homo sapiens ]
• Official Symbol: ADAMTS18
• Synonyms: ADAMTS18; ADAM metallopeptidase with thrombospondin type 1 motif, 18; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 18 , ADAMTS21; A disintegrin and metalloproteinase with thrombospondin motifs 18; disintegrin and metalloprotease-like protein; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 18; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 21; KNO2; ADAMTS21
• Gene ID: 170692
• mRNA Refseq: NM_199355
• Protein Refseq: NP_955387
• MIM: 607512
• UniProt ID: Q8TE60