Recombinant Human ACSS2 protein, GST-tagged

• Cat.No.: ACSS2-3322H
• Product Overview: Recombinant Human ACSS2 protein(), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: ALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQISWNQGIDLWWHELMQEAGDECEPEWCDAEDPLFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVFDFHAEDVFWCTAD
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: ACSS2 acyl-CoA synthetase short-chain family member 2 [ Homo sapiens ]
• Official Symbol: ACSS2
• Synonyms: ACSS2; acyl-CoA synthetase short-chain family member 2; ACAS2, acetyl Coenzyme A synthetase 2 (ADP forming); acetyl-coenzyme A synthetase, cytoplasmic; AceCS; ACS; ACSA; dJ1161H23.1; acetate thiokinase; acetate-CoA ligase; acyl-activating enzyme; cytoplasmic acetyl-coenzyme A synthetase; acetyl-Coenzyme A synthetase 2 (ADP forming); ACAS2; ACECS; DKFZp762G026
• Gene ID: 55902
• mRNA Refseq: NM_001076552
• Protein Refseq: NP_001070020
• MIM: 605832
• UniProt ID: Q9NR19