Recombinant Human Aldehyde Dehydrogenase 1 Family, Member B1, GST-tagged

Cat.No. : ALDH1B1-490H
Product Overview : Recombinant Human ALDH1B1protein was expressed as GST-tagged fusion protein by E. coli and purifiedby Ni-sepharose. The purified protein was resolved in 1M PBS (58mMNa2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.) added with 300mM Imidazole and 0.7% Sarcosyl,15%glycerol. MW=32 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 330-382 aa
Description : ALDH1B1 belongs tothe aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is thesecond enzyme of the major oxidative pathway of alcohol metabolism. ALDH1B1does not contain introns in the coding sequence. The variation of this locusmay affect the development of alcohol-related problems.
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
Bio-activity : Not tested.
Molecular Mass : 32 kDa
AA Sequence : SIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGA
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Applications : Blocking peptide
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name ALDH1B1 aldehyde dehydrogenase 1family, member B1[Homo sapiens]
Official Symbol ALDH1B1
Synonyms ALDH1B1;aldehyde dehydrogenase 1 family, member B1; ALDH5; ALDHX; aldehydedehydrogenase X, mitochondrial; ALDH class 2; aldehyde dehydrogenase 5;acetaldehyde dehydrogenase 5; MGC2230; EC 1.2.1.3; EC 1.2.1;OTTHUMP00000021399
Gene ID 219
mRNA Refseq NM_000692
Protein Refseq NP_000683
MIM 100670
UniProt ID P30837

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ALDH1B1 Products

Required fields are marked with *

My Review for All ALDH1B1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon