Recombinant Human ALDH1B1 protein, His-GST&V5-Myc-tagged

• Cat.No.: ALDH1B1-553H
• Product Overview: Recombinant Human ALDH1B1 protein(P30837)(167-264aa), fused with N-terminal His and GST tag and C-terminal V5 and Myc tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: N-His-GST&C-V5-Myc
• Protein length: 167-264aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 47.6 kDa
• AASequence: SRVISQPDQTLEILMSELDPAVMDQFYMKDGVTAKDVTRESGIRDLIPGSVIDATMFNPCGYSMNGMKSDGTYWTIHITPEPEFSYVSFETNLSQTSY
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: ALDH1B1 aldehyde dehydrogenase 1 family, member B1 [ Homo sapiens ]
• Official Symbol: ALDH1B1
• Synonyms: ALDH1B1; aldehyde dehydrogenase 1 family, member B1; ALDH5; aldehyde dehydrogenase X, mitochondrial; ALDHX; ALDH class 2; aldehyde dehydrogenase 5; acetaldehyde dehydrogenase 5; MGC2230
• Gene ID: 219
• mRNA Refseq: NM_000692
• Protein Refseq: NP_000683
• MIM: 100670
• UniProt ID: P30837