Recombinant Human ACAA1 Protein, GST-Tagged
Cat.No. : | ACAA1-122H |
Product Overview : | Human ACAA1 full-length ORF ( NP_001598.1, 1 a.a. - 424 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 70.7 kDa |
AA Sequence : | MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACAA1 acetyl-CoA acyltransferase 1 [ Homo sapiens ] |
Official Symbol | ACAA1 |
Synonyms | ACAA1; acetyl-CoA acyltransferase 1; acetyl Coenzyme A acyltransferase 1; 3-ketoacyl-CoA thiolase, peroxisomal; peroxisomal 3 oxoacyl Coenzyme A thiolase; beta-ketothiolase; peroxisomal 3-oxoacyl-CoA thiolase; acetyl-Coenzyme A acyltransferase 1; peroxisomal 3-oxoacyl-Coenzyme A thiolase; ACAA; THIO; PTHIO; |
Gene ID | 30 |
mRNA Refseq | NM_001130410 |
Protein Refseq | NP_001123882 |
MIM | 604054 |
UniProt ID | P09110 |
◆ Recombinant Proteins | ||
ACAA1-1167HFL | Recombinant Full Length Human ACAA1 Protein, C-Flag-tagged | +Inquiry |
ACAA1-635H | Recombinant Human ACAA1 Protein, His-tagged | +Inquiry |
ACAA1-784H | Recombinant Human Acetyl-CoA Acyltransferase 1, His-tagged | +Inquiry |
ACAA1-0465H | Recombinant Human ACAA1 Protein (Gly182-Asn424), N-His-tagged | +Inquiry |
ACAA1-122H | Recombinant Human ACAA1 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACAA1-9119HCL | Recombinant Human ACAA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACAA1 Products
Required fields are marked with *
My Review for All ACAA1 Products
Required fields are marked with *
0
Inquiry Basket