Recombinant Human ACAA1 Protein, GST-Tagged

• Cat.No.: ACAA1-122H
• Product Overview: Human ACAA1 full-length ORF ( NP_001598.1, 1 a.a. - 424 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 70.7 kDa
• AA Sequence: MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ACAA1 acetyl-CoA acyltransferase 1 [ Homo sapiens ]
• Official Symbol: ACAA1
• Synonyms: ACAA1; acetyl-CoA acyltransferase 1; acetyl Coenzyme A acyltransferase 1; 3-ketoacyl-CoA thiolase, peroxisomal; peroxisomal 3 oxoacyl Coenzyme A thiolase; beta-ketothiolase; peroxisomal 3-oxoacyl-CoA thiolase; acetyl-Coenzyme A acyltransferase 1; peroxisomal 3-oxoacyl-Coenzyme A thiolase; ACAA; THIO; PTHIO
• Gene ID: 30
• mRNA Refseq: NM_001130410
• Protein Refseq: NP_001123882
• MIM: 604054
• UniProt ID: P09110