Recombinant Full Length Human ACAA1 Protein, C-Flag-tagged
Cat.No. : | ACAA1-1167HFL |
Product Overview : | Recombinant Full Length Human ACAA1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 44.1 kDa |
AA Sequence : | MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMT AVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNG SYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKA ARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSD GAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFAS QAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFE YPGNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Biosynthesis of unsaturated fatty acids, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway, Valine, leucine and isoleucine degradation |
Full Length : | Full L. |
Gene Name | ACAA1 acetyl-CoA acyltransferase 1 [ Homo sapiens (human) ] |
Official Symbol | ACAA1 |
Synonyms | ACAA; THIO; PTHIO; Lnc-Myd88 |
Gene ID | 30 |
mRNA Refseq | NM_001607.4 |
Protein Refseq | NP_001598.1 |
MIM | 604054 |
UniProt ID | P09110 |
◆ Recombinant Proteins | ||
ACAA1-1167HFL | Recombinant Full Length Human ACAA1 Protein, C-Flag-tagged | +Inquiry |
ACAA1-408H | Recombinant Human ACAA1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
ACAA1-26046TH | Recombinant Human ACAA1, His-tagged | +Inquiry |
ACAA1-302H | Recombinant Human ACAA1 Protein (27-331 aa), His-SUMO-tagged | +Inquiry |
ACAA1-424Z | Recombinant Zebrafish ACAA1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACAA1-9119HCL | Recombinant Human ACAA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACAA1 Products
Required fields are marked with *
My Review for All ACAA1 Products
Required fields are marked with *
0
Inquiry Basket