Recombinant Full Length Yop Proteins Translocation Protein R(Yscr) Protein, His-Tagged
Cat.No. : | RFL28025YF |
Product Overview : | Recombinant Full Length Yop proteins translocation protein R(yscR) Protein (P69980) (1-217aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia pestis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-217) |
Form : | Lyophilized powder |
AA Sequence : | MIQLPDEINLIIVLSLLTLLPLISVMATSFVKFAVVFSLLRNALGVQQIPPNMAMYGLAI ILSLYVMAPVGFATQDYLQANEVSLTNIESVEKFFDEGLAPYRMFLKQHIQAQEYSFFVD STKQLWPKQYADRLESDSLFILLPAFTVSELTRAFEIGFLIYLPFIVIDLVISNILLAMG MMMVSPMTISLPFKLLLFVLLDGWTRLTHGLVISYGG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yscR |
Synonyms | yscR; YPCD1.44; y5034; y0037; YP_pCD39; Yop proteins translocation protein R |
UniProt ID | P69980 |
◆ Recombinant Proteins | ||
CDK5RAP3-787R | Recombinant Rhesus monkey CDK5RAP3 Protein, His-tagged | +Inquiry |
Il13ra2-7459R | Recombinant Rat Il13ra2 protein(Met1-Lys336), His-tagged | +Inquiry |
HOXD3-3735HF | Recombinant Full Length Human HOXD3 Protein, GST-tagged | +Inquiry |
MRPS12-6458HF | Recombinant Full Length Human MRPS12 Protein, GST-tagged | +Inquiry |
METTL18-6165HF | Recombinant Full Length Human METTL18 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1811M | Active Native Maclura Pomifera Lectin Protein, Fluorescein labeled | +Inquiry |
CRP-5299H | Native Human C-Reactive Protein, Pentraxin-Related | +Inquiry |
Heart-005H | Human Heart Lysate, Total Protein | +Inquiry |
C4B-10H | Native Human C4B Protein | +Inquiry |
F12-28805TH | Native Human F12 | +Inquiry |
◆ Cell & Tissue Lysates | ||
Fetal Colon-135H | Human Fetal Colon Lysate | +Inquiry |
FAIM2-6465HCL | Recombinant Human FAIM2 293 Cell Lysate | +Inquiry |
LITAF-4722HCL | Recombinant Human LITAF 293 Cell Lysate | +Inquiry |
ZNF276-105HCL | Recombinant Human ZNF276 293 Cell Lysate | +Inquiry |
SLC51A-461HCL | Recombinant Human SLC51A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yscR Products
Required fields are marked with *
My Review for All yscR Products
Required fields are marked with *
0
Inquiry Basket