Recombinant Full Length Human METTL18 Protein, GST-tagged

• Cat.No.: METTL18-6165HF
• Product Overview: Human METTL18 full-length ORF (BAG36632.1, 1 a.a. - 372 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 372 amino acids
• Description: METTL18 (Methyltransferase Like 18) is a Protein Coding gene. GO annotations related to this gene include methyltransferase activity and protein methyltransferase activity.
• Molecular Mass: 67.32 kDa
• AA Sequence: MTFQFNFTIEDHLENELTPIRDGALTLDSSKELSVSESQKGEERDRKCSAEQFDLPQDHLWEHKSMENAAPSQDTDSPLSAASSSRNLEPHGKQPSLRAAKEHAMPKDLKKMLENKVIETLPGFQHVKLSVVKTILLKENFPGENIVSKSFSSHSDLITGVYEGGLKIWECTFDLLAYFTKAKVKFAGKKVLDLGCGSGLLGITAFKGGSKEIHFQDYNSMVIDEVTLPNVVANSTLEDEENDVNEPDVKRCRKPKVTQLYKCRFFSGEWSEFCKLVLSSEKLFVKYDLILTSETIYNPDYYSNLHQTFLRLLSKNGRVLLASKAHYFGVGGGVHLFQKFVEERDVFKTRILKIIDEGLKRFIIEITFKFPG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: METTL18 methyltransferase like 18 [ Homo sapiens ]
• Official Symbol: METTL18
• Synonyms: HPM1; AsTP2; C1orf156; RP1-117P20.4
• Gene ID: 92342
• mRNA Refseq: NM_033418
• Protein Refseq: NP_219486
• MIM: 615255
• UniProt ID: O95568