Recombinant Full Length Human MRPS12 Protein, GST-tagged

• Cat.No.: MRPS12-6458HF
• Product Overview: Human MRPS12 full-length ORF ( AAH01617, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 138 amino acids
• Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S12P family. The encoded protein is a key component of the ribosomal small subunit and controls the decoding fidelity and susceptibility to aminoglycoside antibiotics. The gene for mitochondrial seryl-tRNA synthetase is located upstream and adjacent to this gene, and both genes are possible candidates for the autosomal dominant deafness gene (DFNA4). Splice variants that differ in the 5 UTR have been found for this gene; all three variants encode the same protein. [provided by RefSeq
• Molecular Mass: 40.92 kDa
• AA Sequence: MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MRPS12 mitochondrial ribosomal protein S12 [ Homo sapiens (human) ]
• Official Symbol: MRPS12
• Synonyms: MRPS12; mitochondrial ribosomal protein S12; RPS12; RPMS12; RPSM12; MPR-S12; MT-RPS12; 28S ribosomal protein S12, mitochondrial; MRP-S12; S12mt; mitochondrial small ribosomal subunit protein uS12m
• Gene ID: 6183
• mRNA Refseq: NM_021107
• Protein Refseq: NP_066930
• MIM: 603021
• UniProt ID: O15235