Recombinant Full Length Shewanella Denitrificans Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL30343SF |
Product Overview : | Recombinant Full Length Shewanella denitrificans Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q12M46) (1-600aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shewanella denitrificans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-600) |
Form : | Lyophilized powder |
AA Sequence : | MTASPKNEMSTVFKRLMTYVMPMKGMLTLSILGLIVYGLVDAAFIAFIKPFIDEGFSQNP TVVAGVELPTSGGFSANKDVMLMAPLVVIGMFTLRGVANFVSTYCISYLSAQLIMDMRQQ VFEHYLRLPVSYIDRENSGNLISRVTFDTEQIARASGSALISIVRDSITVIGMLALMFFY SWKLSLCILVIGPLMGVVISIVSKRFRKVSVQIQSAMGGVTATTEQMIKGHKNVLSFGGQ ETESKRFYEVNDRNRYQNMKLAMAQSVSQPVIMIIGSFALAFVLYAASLDSMKLELTAGT FAAILGAMLAMLQPIKNLTRVNAEFQRGIAACTTVFELLDTLPESDTGAHQVERVQGHLR FDNVSFSYPGQAKPALNNIDFDVKPGKTVALVGRSGSGKSTMASLITRFYTGLEQGDIRL DDVSIYDYSLKSLRSQVALVSQQVTLFNDSIANNIAYAYPGEVSREQILKAATLAHAMEF IEQLPEGLDTQVGENGVLLSGGQRQRIAIARAMLRDAPVLILDEATSALDTESEKAIQLG LDNLRHNRTSIVIAHRLSTIESADEILVIDQGKIIERGTHASLIEKKGAYAGLYQMQFGE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; Sden_2199; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q12M46 |
◆ Recombinant Proteins | ||
DNMT1-198H | Active Recombinant Human DNMT1 protein, MYC/DDK-tagged | +Inquiry |
GRA6-272T | Recombinant Toxoplasma Gondii GRA6 protein, His-tagged | +Inquiry |
PER1-4377R | Recombinant Rat PER1 Protein | +Inquiry |
RFL18985AF | Recombinant Full Length Arabidopsis Thaliana Ethylene Receptor 1(Etr1) Protein, His-Tagged | +Inquiry |
NAIF1-5236H | Recombinant Human NAIF1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Factor 4-88H | Native Human Platelet Factor 4 | +Inquiry |
Lectin-1759C | Active Native Canavalia ensiformis Concanavalin A Protein, Fluorescein Labeled | +Inquiry |
Collagen-49B | Native Bovine Collagen Type XI/XI | +Inquiry |
PLG -38C | Native Chicken plasmin | +Inquiry |
Glycated Albumin-006B | Native Bovine Glycated Albumin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCDH21-1294HCL | Recombinant Human PCDH21 cell lysate | +Inquiry |
DNAJC9-6869HCL | Recombinant Human DNAJC9 293 Cell Lysate | +Inquiry |
CD14-1169CCL | Recombinant Cynomolgus CD14 cell lysate | +Inquiry |
WDR37-350HCL | Recombinant Human WDR37 293 Cell Lysate | +Inquiry |
COL21A1-380HCL | Recombinant Human COL21A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket