Recombinant Full Length Candida Glabrata Palmitoyltransferase Swf1(Swf1) Protein, His-Tagged
Cat.No. : | RFL11383CF |
Product Overview : | Recombinant Full Length Candida glabrata Palmitoyltransferase SWF1(SWF1) Protein (Q6FXC6) (1-330aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida Glabrata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-330) |
Form : | Lyophilized powder |
AA Sequence : | MLLFLVFILVVSQVVLLLLSPQFRDKFIFRWYYDEVYKPMILDNSRYRIKFYVVPVFYLS VYSYMVYIFYSRTFAIISPMLTSIETYVVIPLMLILPLFFGSMSMIIKPDSSNAHQIGSE KRYPYDNLLYFPQHECRTCKQVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFY SFLCSNLLLLSYSFIRLIFIQFNKSAYNTTPTGEKSLLILSILCGSFTVILAVYCYFVFE LVNSGMTTNEKDKWQMVHDYINTGDLVRDPEGKYFIKYQNGGNNYEFYSTDSYDGTQYTI VDYFTVKSPAEITNIYDKGNFINNLREFIG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SWF1 |
Synonyms | SWF1; CAGL0B01991g; Palmitoyltransferase SWF1 |
UniProt ID | Q6FXC6 |
◆ Recombinant Proteins | ||
TNFRSF25-2081H | Recombinant Human TNFRSF25, Fc Chimera | +Inquiry |
ANTXR1-2158H | Recombinant Human ANTXR1 Protein, MYC/DDK-tagged | +Inquiry |
PAK2-4260R | Recombinant Rat PAK2 Protein | +Inquiry |
Tgoln2-6402M | Recombinant Mouse Tgoln2 Protein, Myc/DDK-tagged | +Inquiry |
NOC-0433B | Recombinant Bacillus subtilis NOC protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ACP-150P | Active Native Potato Acid Phosphatase | +Inquiry |
IgG-166R | Native Rat IgG Fc fragment | +Inquiry |
EDN2-8310H | Native Human EDN2 | +Inquiry |
Fgg-5421R | Native Rat Fibrinogen Gamma Chain | +Inquiry |
PMPCB-284H | Native Human PMPCB, DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINA1A-003MCL | Recombinant Mouse SERPINA1A cell lysate | +Inquiry |
ANPEP-3090HCL | Recombinant Human ANPEP cell lysate | +Inquiry |
INF2-5209HCL | Recombinant Human INF2 293 Cell Lysate | +Inquiry |
DNAJC7-6870HCL | Recombinant Human DNAJC7 293 Cell Lysate | +Inquiry |
ASPH-8643HCL | Recombinant Human ASPH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SWF1 Products
Required fields are marked with *
My Review for All SWF1 Products
Required fields are marked with *
0
Inquiry Basket