Recombinant Full Length Candida Albicans Palmitoyltransferase Swf1(Swf1) Protein, His-Tagged
Cat.No. : | RFL35419CF |
Product Overview : | Recombinant Full Length Candida albicans Palmitoyltransferase SWF1(SWF1) Protein (Q5A861) (1-353aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida albicans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-353) |
Form : | Lyophilized powder |
AA Sequence : | MLFTLIVCLTIISSLATFLLLFGDSPSFRNTPIQKLRNSLLSISRDIFQFYHWLDEKLNG QLLKILNWLVPVGYVMVVTVCFQQFLTHTLPMLSSPGLFRLFTIYFSMVLIYASTILAAF SDPGRITTINLKSYPYTPNQLIFFDGKTCSTCHIAKPARSKHCSVCNQCFLLYDHHCVWI NNCVGYYNYKWFMLFLISNINMLGYGGWLCYWALTPVSWRKITSTNNANKVTGIFLILCS IFIVITTLFTFLHLRYIYLGVTTNELDKWSEIDHLVGLGVLYQIEPSIANENYVERAILD GNAVYISLKDERILIYNSNVKNFKLQLIQSVEDDLVNIYDHGFWNNLIERLKW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SWF1 |
Synonyms | SWF1; CAALFM_CR00870CA; CaO19.10777; CaO19.3267; Palmitoyltransferase SWF1 |
UniProt ID | Q5A861 |
◆ Recombinant Proteins | ||
MYF6-5836M | Recombinant Mouse MYF6 Protein, His (Fc)-Avi-tagged | +Inquiry |
PENK-177H | Recombinant Human PENK, His-tagged | +Inquiry |
RFL951SF | Recombinant Full Length Staphylococcus Aureus Upf0060 Membrane Protein Nwmn_2240 (Nwmn_2240) Protein, His-Tagged | +Inquiry |
SEMA7A-6486Z | Recombinant Zebrafish SEMA7A | +Inquiry |
ANTXR1-575M | Recombinant Mouse ANTXR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Fxa-66R | Native Rat Factor Ixa | +Inquiry |
IgE-205H | Active Native Human Immunoglobulin E | +Inquiry |
LOC780933-1B | Native Bovine Anhydrotrypsin | +Inquiry |
CVB5-13 | Native Coxsackievirus B5 Antigen | +Inquiry |
CCL25-31214TH | Native Human CCL25 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ART3-1148HCL | Recombinant Human ART3 cell lysate | +Inquiry |
PPID-2972HCL | Recombinant Human PPID 293 Cell Lysate | +Inquiry |
Arabidopsis-389P | Plant Plant: Arabidopsis Lysate | +Inquiry |
GPR157-741HCL | Recombinant Human GPR157 cell lysate | +Inquiry |
Prostate-405H | Human Prostate Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SWF1 Products
Required fields are marked with *
My Review for All SWF1 Products
Required fields are marked with *
0
Inquiry Basket