Recombinant Full Length Neisseria Gonorrhoeae Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL7781NF |
Product Overview : | Recombinant Full Length Neisseria gonorrhoeae Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q5F4X8) (1-622aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neisseria gonorrhoeae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-622) |
Form : | Lyophilized powder |
AA Sequence : | MIEKLTFGLFKKEDARSFMRLMAYVRPYKIRIVAALIAIFGVAATESYLAAFIAPLINHG FSAPAAPPDLSAAAGILSTLQNWREQFTYMVWGTENKIWTVPLFLIILVVIRGICRFTST YLMTWVSVMTISKIRKDMFAKMLTLSSRYHQETPSGTVLMNMLNLTEQSVSNASDIFTVL TRDTMIVTGLTIVLLYLNWQLSLIVVLMFPLLSLLSRYYRDRLKHVISDSQKSIGTMNNV IAETHQGHRVVKLFNGQAQAANRFDAVNRTIVRLSKKITQATAAHSPFSELIASIALAVV IFIALWQSQNGYTTIGEFMAFIVAMLQMYAPIKSLANISIPMQTMFLAADGVCAFLDTPP EQDKGTLAPQRVEGRISFRNVDVEYRSDGIKALDNFNLDIRQGERVALVGRSGSGKSTVV NLLPRFVEPSAGNICIDGIDIADIKLDCLRAQFALVSQDVFLFDDTLFENVRYSRPDAGE AEVLSALQAANLQSLIDASPLGLHQPIGSNGSNLSGGQRQRVAIARAILKDAPILLLDEA TSALDNESERLVQQALERLMENRTGIIVAHRLTTVESADRIIVMDGGKIIEQGTHDQLMF QNGYYTMLRNISGKDTAAVQTA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; NGO2165; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q5F4X8 |
◆ Recombinant Proteins | ||
SHC3-4009R | Recombinant Rhesus Macaque SHC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC39A12-8363M | Recombinant Mouse SLC39A12 Protein, His (Fc)-Avi-tagged | +Inquiry |
DCTPP1-1198R | Recombinant Rhesus monkey DCTPP1 Protein, His-tagged | +Inquiry |
FGF10-195H | Recombinant Human FGF10 protein, His/S-tagged | +Inquiry |
RFL18462PF | Recombinant Full Length Pseudomonas Putida Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
FGA-42D | Native Canine Fibrinogen, FITC Labeled | +Inquiry |
Sphingomyelinase-38S | Active Native Staphylococcus aureus Sphingomyelinase | +Inquiry |
Pepsin-27H | Native Human Pepsin (PP) Protein | +Inquiry |
NEFH-181B | Native Bovine NEFH Protein | +Inquiry |
VTN-31737TH | Native Human VTN | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNASE1L2-229HCL | Recombinant Human DNASE1L2 lysate | +Inquiry |
SLC6A7-1703HCL | Recombinant Human SLC6A7 293 Cell Lysate | +Inquiry |
BTG2-8392HCL | Recombinant Human BTG2 293 Cell Lysate | +Inquiry |
T-47D-2138H | T-47D (human breast duct carinoma) nuclear extract lysate | +Inquiry |
NDST1-435HCL | Recombinant Human NDST1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket