Recombinant Full Length Sodalis Glossinidius Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL13408SF |
Product Overview : | Recombinant Full Length Sodalis glossinidius Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q2NUA5) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sodalis glossinidius |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MLNDKDLSTWQTFRRLWPMISPFKTGLIVAAIALILNAASDTFMLSLLKPLLDDGFGKAN SNILVWMPLVVIGLMVLRGVSGFVSSYCVSWVSGKVIMNMRRRLFNHMMDMPVSFFDQQS TGTLLSRITYDSEQVASSSSGALITVIREGASIIGLFAMMFYYSWQLSLILVVIAPVVSF AIRQVSKRFRQISKRMQNTMGQVTTSAEQMLKGHKEVLIFGGQKVENERFNSVSNRMRQQ GMKMVAASSVSDPLIQFIASLALAFVLYAASFPSVMETLTAGTITVVFSSMIALMRPLKS LTNVNAQFQRGMAACQTLFSILDMETEKDEGTVEVERVKGDIAFDHVTFSYPGKETPSLH DISLSIPTGHTVALVGRSGSGKSTIANLLTRFYDIQQGQILLDGTDLRAYKLASLRNQVA LVSQNVHLFNDTIANNIAYARKATYSRKQIENAARMAYAMDFIEKMDQGLDTVIGENGVL LSGGQRQRIAIARALLRDCPILILDEATSALDTESERAIQKALDALQKNRTSLVIAHRLS TIEKADEILVVVEGRIVERGNHEELMSRQGVYAQLHQLQFGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; SG0995; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q2NUA5 |
◆ Recombinant Proteins | ||
Scarb1-5704M | Recombinant Mouse Scarb1 Protein, Myc/DDK-tagged | +Inquiry |
NABP1-270H | Recombinant Human nucleic acid binding protein 1, His-tagged | +Inquiry |
TRIM5a-149H | Recombinant Human TRIM5a Protein, His-tagged | +Inquiry |
Chst12-2159M | Recombinant Mouse Chst12 Protein, Myc/DDK-tagged | +Inquiry |
NCAM2-5928M | Recombinant Mouse NCAM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
H3N2-03I | Active Native IAV H3N2 Protein | +Inquiry |
APOC1-27328TH | Native Human APOC1 protein | +Inquiry |
FGG-7H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
FTH1-1868H | Native Human Ferritin, Heavy Polypeptide 1 | +Inquiry |
LOC780933-24B | Native Bovine Immobilized Anhydrotrypsin | +Inquiry |
◆ Cell & Tissue Lysates | ||
DGCR2-6964HCL | Recombinant Human DGCR2 293 Cell Lysate | +Inquiry |
UBE2J1-572HCL | Recombinant Human UBE2J1 293 Cell Lysate | +Inquiry |
PHKA2-1346HCL | Recombinant Human PHKA2 cell lysate | +Inquiry |
WNT2-298HCL | Recombinant Human WNT2 293 Cell Lysate | +Inquiry |
SORBS2-1570HCL | Recombinant Human SORBS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket