Recombinant Full Length Legionella Pneumophila Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL7940LF |
Product Overview : | Recombinant Full Length Legionella pneumophila Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q5X498) (1-588aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Legionella Pneumophila |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-588) |
Form : | Lyophilized powder |
AA Sequence : | MKNNLPIKSRLLYKRLLSYVKPFWPVLLLGVLANILYSGIDAGFTYMTKLFLDKSFITID LDFVKQIPLIVLIGITLRGLVSSLGSYCMTWVARSVVKVLRQTVFSHIIHLPADYYDEAT SGQLLSKILYDVEQVAQVSADALTDFIQNICLVIGLLTVMMVICWQLSLMFLLTIPFVGI IVNYTNKRVRRISHKVQKTMGEVTEIASEAIEGYRVVRIFGGERYEITKFNKATEYSRKN DMKVAISKAINVSGVQLVIAIGIAMIIMAAIHLSTVITISAGSFLAIIAAMLQLIKPMKT LTTLNATIQRGLAGAESVFNLLDLPLERNNGLILKEKVRGEIEFKHVYHAYRQSQNILHD VNFVIEAGTSVALVGHSGSGKTTIASLLPRFYELSQGMITLDGMPIQQLSLESLRKQISL VSQNVTLFNDTLANNIAYGRFDASREQIITAAKLAYADEFIKQLPDGYDTRVGENGVLLS GGQRQRIAIARAILKDAPILILDEATSALDSESEHYIQAALEQVMKGRTTLIIAHRLSTI KHAHKIIVLQHGRIVEQGSHQELLDMDGHYAQLYKVQQFGRINEEVVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; lpp1782; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q5X498 |
◆ Native Proteins | ||
LOX3-11S | Native Soybeans LOX3 Protein | +Inquiry |
Mucin-357 | Native Porcine Mucin protein | +Inquiry |
Lectin-1858V | Active Native Vicia Villosa Lectin Protein | +Inquiry |
Tryptase-61H | Native Human Mast Cell Tryptase | +Inquiry |
SERPINC1-26143TH | Native Human SERPINC1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
Thymus-126M | Mouse Thymus Tissue Lysate | +Inquiry |
NMB-3795HCL | Recombinant Human NMB 293 Cell Lysate | +Inquiry |
RBP4-2304MCL | Recombinant Mouse RBP4 cell lysate | +Inquiry |
PSMC2-2764HCL | Recombinant Human PSMC2 293 Cell Lysate | +Inquiry |
GNL3-5847HCL | Recombinant Human GNL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket