Recombinant Full Length Twik Family Of Potassium Channels Protein 12(Twk-12) Protein, His-Tagged
Cat.No. : | RFL16403CF |
Product Overview : | Recombinant Full Length TWiK family of potassium channels protein 12(twk-12) Protein (A8X8I4) (1-687aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis briggsae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-687) |
Form : | Lyophilized powder |
AA Sequence : | MTLFQKLQWFCQLIRLRAYYKFLLLIAYTLFGAWLFRFYELQADIKRRAIYGNDTNLIRR QLAERWIEMHDDAVLRNNSVLRRRRAAEAVDWLLGELNLSDHMREFSEDTPWTWTGAMFY AGQLYTTIGYGYPTAKTDEGRICTVLYALFGIPCFLMYLKAIGKTLSKRLKKIYKRVRRS AFGKFLLPTRVTATKDGFEDPDASAEERKRKPFPIPIAIILLIIWICFSASMFCQWEKTW DFPSAVYFFIVSISTVGLGDMLFRTPDMMVFNFLLILFGLALLSMCFELITDRIAKWKQK RFDEHIKKVQKMAFQVFEKDPFVEEAPPLGIRMAPNLMQIAATHVSEEKRGFFAELKDWF AGKVTDNVIQSKLEDTDDESDEDEALEEFESPQVATLTANDLVVCTNGGATRRVSKQSYA FSDVSNLSNSKIPPGNNYGQLLDRIKAMEKFKPKKGDLDSRMFAKFLENKKLAKILEQTE LRELATVSCQTDLSGLVVQRRNPKGRHARIGSCSSQSTMSTFLPRNNSHAPDEDSVMSIT FGDLKFDYITEPLIDEYHLRESNHSIFDFDDDEVVRIPQKMLVSRPGMPPPPPSRPSQLA SPLRALLEKEQKYDEDPEIQLTPRRLASLTDVQARKVKLGYDENLQHARLVCGLLPQDFD SPSTSTSTSMIDSGYDLSKRDAPVNIV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | twk-12 |
Synonyms | twk-12; CBG09670; TWiK family of potassium channels protein 12 |
UniProt ID | A8X8I4 |
◆ Recombinant Proteins | ||
Trh-488M | Recombinant Mouse Trh Protein, His-tagged | +Inquiry |
CABP7-2769HF | Recombinant Full Length Human CABP7 Protein, GST-tagged | +Inquiry |
Prnp-803B | Recombinant Bovine Prion Protein (A144V), His-tagged | +Inquiry |
Reps2-5463M | Recombinant Mouse Reps2 Protein, Myc/DDK-tagged | +Inquiry |
CHEK2-1188H | Recombinant Human CHEK2 Protein (S2-L543), Tag Free | +Inquiry |
◆ Native Proteins | ||
Lectin-1834R | Active Native Ricinus Communis Agglutinin II Protein | +Inquiry |
Insulin-04B | Native Bovine Insulin Protein | +Inquiry |
Acid phosphatase-158 | Active Native Wheat Germ Acid phosphatase Protein | +Inquiry |
CRP-5299H | Native Human C-Reactive Protein, Pentraxin-Related | +Inquiry |
ALB-584P | Native Guinea Pig ALB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGR3-1992CCL | Recombinant Cynomolgus FCGR3 cell lysate | +Inquiry |
NEK8-1184HCL | Recombinant Human NEK8 cell lysate | +Inquiry |
ECD-001HCL | Recombinant Human ECD cell lysate | +Inquiry |
NRSN2-3691HCL | Recombinant Human NRSN2 293 Cell Lysate | +Inquiry |
TLCD1-1052HCL | Recombinant Human TLCD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All twk-12 Products
Required fields are marked with *
My Review for All twk-12 Products
Required fields are marked with *
0
Inquiry Basket