Recombinant Full Length Trichophyton Verrucosum Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL24003TF |
Product Overview : | Recombinant Full Length Trichophyton verrucosum Formation of crista junctions protein 1(FCJ1) Protein (D4DHX2) (12-683aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Trichophyton verrucosum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (12-683) |
Form : | Lyophilized powder |
AA Sequence : | LGSLARQRLTTSGRNLITKRSYIEGKSAAWPSGRSIASVLPARKTSCATFTTSATRGNEQ NIRSPPSPSSASAISPEGISRPASSSPAGQTSPGSSVNPPEPPKAQTGAPPPPPPPPPAP KAKGRFGRSLLYLVLTAGVAYAGGVWFSLRSDNFHDFFTEYVPYGEEAVLYFEELDFRRR FPNATRHINTRPAAPRDEGEKVTIPSKSGVSWKVAENEGTSDVTHKGRHMSAVDAEVFRT GGDAKSASNKPTTEDKKGSEKTGSKKDESKERVPVTDTKKSTVSLDEPRKPAVATVSSIE PLAALQDDPIIQELTKIVNGLIAVINADESASKLAAPIAKAKDDFLKLGEQISSIKKEAH IAAQEEIKNAHKEFERSATELVRRIDEVRSEEAAEYREEFETEREKLANSYQEKIKTEVE RANAVAEQRLRNELVEQAIQLNRKFLSDVDTLVEKERQGRFSKLSELSAQVAELEKLTAG WNEVIGANLTTQQLQVAVDAVHSALESESMPRPFINELLAVKSLAGQDPIVNAAISSINP TAYQRGIPSTAQIIDRFRRVANEVRKASLLPEDAGVASHATSYLMSKVMFKKEASSSGDD VESILTRTEKLLEQGNLDDAAREMNALRGWSKLLSKDWLADVRRVLEVRQALEVCFLFLL PTLSLLIYYNEY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; TRV_06779; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | D4DHX2 |
◆ Recombinant Proteins | ||
HVCN1-494Z | Recombinant Zebrafish HVCN1 | +Inquiry |
VOM1R94-6535R | Recombinant Rat VOM1R94 Protein | +Inquiry |
Envelope 3-597D | Recombinant Dengue Virus Subtype 3 Envelope protein, His-tagged | +Inquiry |
Pim1-7908R | Recombinant Rat Pim1 protein, His-tagged | +Inquiry |
SLC26A4-2734H | Recombinant Human SLC26A4, GST-tagged | +Inquiry |
◆ Native Proteins | ||
PRTN3-01H | Native Human PRTN3 Protein | +Inquiry |
VTN-2H | Native Human monomeric vitronectin, Biotin labeled | +Inquiry |
GFAP-171B | Native bovine GFAP | +Inquiry |
MPOC-235H | Active Native Human Myeloperoxidase Isoform C | +Inquiry |
Lectin-1730P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Rhodamine labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
Fetal Thymus-173H | Human Fetal Thymus Lysate | +Inquiry |
KRTAP2-4-4846HCL | Recombinant Human KRTAP2 293 Cell Lysate | +Inquiry |
CYSLTR2-7096HCL | Recombinant Human CYSLTR2 293 Cell Lysate | +Inquiry |
SpinalCord-576M | MiniPig Spinal Cord Lysate, Total Protein | +Inquiry |
Placenta-650B | Bovine Placenta Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket