Recombinant Full Length Thiomicrospira Crunogena Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL7596HF |
Product Overview : | Recombinant Full Length Thiomicrospira crunogena Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q31FG2) (1-581aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Hydrogenovibrio crunogenus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-581) |
Form : | Lyophilized powder |
AA Sequence : | MFDRHTLSLYKRLLKYISGYKSAIFITLITIAIIAATEPLSAIILGNLVDESLIEKDPNS FLLLPLQLAAVFIVKGVAEYFSKVMSTWIAQKAIFNIRSELYDKMLCLPQAEHNQTSTGT LMSKVTYDVTQTGNALSEAWIVIARDSLTILALLATLIYYSWQLTLVMLIIGPIVAFFID RAGKLMRTSSTDMQDNMGEMTHRLEEGLKGYQDIKIYGSEKYELDRFKASAESLRQNTMK VIKVSALNVPLVQVIAAIALSIVVYIAVQMVNAETMTAGNLITYVTAMGLIFEPIRRITN INATVQRGMAAAKSIFAILDTPSEANNGKIELSNVNGQIDFNNVSFSYLGTEKTALNNFS LSIPARKTTALVGQSGSGKTTLANLITRFYQVNHGTITIDGIALDEIELNNLRANIAFVS QNVVLFNDTIAANIAYGHEEYDEQAIMNAAKAAHAWEFIEKLPEGLNTIIGDNGTLLSGG QRQRLAIARAFLKNAPILIMDEATSALDNQSEKLIQEAMNSLRKNRTVIIIAHRLSTIEN ADKIVVLEEGSLKEQGTHAELMALNSIYSQLYKQGNLSEQV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; Tcr_1519; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q31FG2 |
◆ Native Proteins | ||
F2-303R | Native Rat Thrombin | +Inquiry |
C3b-09R | Native Rat C3b Protein | +Inquiry |
Immunoglobulin G1-81H | Native Human Immunoglobulin G1 | +Inquiry |
FGG-7H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
Urease-52J | Active Native Jack Bean Urease | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGSF8-1378MCL | Recombinant Mouse IGSF8 cell lysate | +Inquiry |
SLC26A6-1752HCL | Recombinant Human SLC26A6 293 Cell Lysate | +Inquiry |
UTP3-1561HCL | Recombinant Human UTP3 cell lysate | +Inquiry |
CALM3-7888HCL | Recombinant Human CALM3 293 Cell Lysate | +Inquiry |
P2RX5-3498HCL | Recombinant Human P2RX5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket