Recombinant Full Length Streptococcus Pneumoniae Pts System Mannitol-Specific Eiicb Component(Mtla) Protein, His-Tagged
Cat.No. : | RFL31964SF |
Product Overview : | Recombinant Full Length Streptococcus pneumoniae PTS system mannitol-specific EIICB component(mtlA) Protein (Q8DR34) (1-589aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptococcus pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-589) |
Form : | Lyophilized powder |
AA Sequence : | MEEKVSLKVRVQKLGTSLSNMVMPNIGAFIAWGVLTALFIADGYLPNEQLATVVGPMLTY LLPILIGYTGGYMIHGQRGAVVGSIATVGAITGSSVPMFIGAMVMGPLGGWTIKKFDEKF QEKIRPGFEMLVNNFSAGLVGFALLLLAFYAIGPVVSTLTGAVGNGVEAIVNARLLPMAN IIIEPAKVLFLNNALNHGIFTPLGVEQVAQAGKSILFLLEANPGPGLGILLAYAVFGKGS AKSSSWGAMVIHFFGGIHEIYFPYVMMKPTLFLAAMAGGISGTFTFQLLDAGLKSPASPG SIIAIMATAPKGVWPHLNILLGVLVAAVVSFLIAALILHADKSTEDSLEAAQAATQAAKA QSKGQLVSTSVDAVVSTDSVEKIIFACDAGMGSSAMGASILRDKVKKAGLELPVSNQAIS NLLDTPKTLIVTQEELTPRAKDKSPSAIHVSVDNFLASPRYDEIVASLTGASPIAEIEGD IPTSAPVDSQEIDLNHIDAVVVAYGKAQGTATMGCETIRAIFRNKNIRIPVSTAKISELG EFNSKNIMIVTTISLQAEVQQAAPNSQFLIVDSLVTTPEYDKMAARMYK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mtlA |
Synonyms | mtlA; spr0356; PTS system mannitol-specific EIICB component; EIICB-Mtl; EII-Mtl [Includes: Mannitol permease IIC component; PTS system mannitol-specific EIIC component; Mannitol-specific phosphotransferase enzyme IIB component; PTS system mannitol-specifi |
UniProt ID | Q8DR34 |
◆ Recombinant Proteins | ||
YWHAE-150H | Recombinant Human YWHAE Protein, His-tagged | +Inquiry |
RFL9352AF | Recombinant Full Length Avian Infectious Bronchitis Virus Membrane Protein(M) Protein, His-Tagged | +Inquiry |
LUM-2593R | Recombinant Rhesus monkey LUM Protein, His-tagged | +Inquiry |
SGO1-1342H | Recombinant Human SGO1 Protein, MYC/DDK-tagged | +Inquiry |
DPCR1-2823H | Recombinant Human DPCR1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
PLC-30 | Active Native Phospholipase C | +Inquiry |
Lectin-1747L | Active Native Lotus Tetragonolobus Lectin Protein | +Inquiry |
ACTN3-3280C | Native Chicken ACTN3 | +Inquiry |
FN1-700H | Native Human Fibronectin 1 | +Inquiry |
PLG-30880TH | Native Human PLG | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLTB-7426HCL | Recombinant Human CLTB 293 Cell Lysate | +Inquiry |
ACAN-35HCL | Recombinant Human ACAN cell lysate | +Inquiry |
PACRG-3475HCL | Recombinant Human PACRG 293 Cell Lysate | +Inquiry |
Fetal Brain-132H | Human Fetal Brain Stem Lysate | +Inquiry |
PIK3CD-3187HCL | Recombinant Human PIK3CD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All mtlA Products
Required fields are marked with *
My Review for All mtlA Products
Required fields are marked with *
0
Inquiry Basket