Recombinant Full Length Pts System Mannitol-Specific Eiicb Component(Mtla) Protein, His-Tagged
Cat.No. : | RFL9300SF |
Product Overview : | Recombinant Full Length PTS system mannitol-specific EIICB component(mtlA) Protein (Q97SH4) (1-589aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptococcus pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-589) |
Form : | Lyophilized powder |
AA Sequence : | MEEKVSLKVRVQKLGTSLSNMVMPNIGAFIAWGVLTALFIADGYLPNEQLATVVGPMLTY LLPILIGYTGGYMIHGQRGAVVGAIATVGAITGSSVPMFIGAMVMGPLGGWTIKKFDEKF QEKIRPGFEMLVNNFSAGLVGFALLLLAFYAIGPVVSTLTGAVGNGVEAIVNARLLPMAN IIIEPAKVLFLNNALNHGIFTPLGVEQVAQAGKSILFLLEANPGPGLGILLAYAVFGKGS AKSSSWGAMVIHFFGGIHEIYFPYVMMKPTLFLAAMAGGISGTFTFQLLDAGLKSPASPG SIIAIIATAPKGVWPHLNVLLGVLVAAVVSFLVAALILHADKSTEDSLEAAQAATQAAKA QSKGQLVSTSVDAVVSTDSVEKIIFACDAGMGSSAMGASILRDKVKKAGLEIPVSNQAIS NLLDTPKTLIVTQEELTPRAKDKSPSAIHVSVDNFLASSRYDEIVASLTGASPIAEIEGD IPTSAPVDSQESDLNHIDAVVVAYGKAQGTATMGCETIRAIFRNKNIRIPVSTAKISELG EFNSKNIMIVTTISLQAEVQQAAPNSQFLIVDSLVTTPEYDKMAARMYK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mtlA |
Synonyms | mtlA; SP_0394; PTS system mannitol-specific EIICB component; EIICB-Mtl; EII-Mtl [Includes: Mannitol permease IIC component; PTS system mannitol-specific EIIC component; Mannitol-specific phosphotransferase enzyme IIB component; PTS system mannitol-specifi |
UniProt ID | Q97SH4 |
◆ Recombinant Proteins | ||
CRYM-1281R | Recombinant Rat CRYM Protein, His (Fc)-Avi-tagged | +Inquiry |
RAP1GAP-1129H | Recombinant Human RAP1 GTPase Activating Protein | +Inquiry |
ASB7-423R | Recombinant Rhesus monkey ASB7 Protein, His-tagged | +Inquiry |
ZNF443-3849H | Recombinant Human ZNF443, His-tagged | +Inquiry |
CLEC3B-5642H | Recombinant Human CLEC3B protein, His-tagged, low endotoxin | +Inquiry |
◆ Native Proteins | ||
ALA-02B | Native Bovine α-Lactalbumin Protein | +Inquiry |
LDH-227H | Active Native Human Lactate Dehydrogenase Total | +Inquiry |
IgG-150G | Native Goat IgG Fab fragment | +Inquiry |
Stomach-004H | Human Stomach Lysate, Total Protein | +Inquiry |
HBsAg-8H | Native Hepatitis Surface Antigen subtype Ay protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM122B-6442HCL | Recombinant Human FAM122B 293 Cell Lysate | +Inquiry |
DIXDC1-6917HCL | Recombinant Human DIXDC1 293 Cell Lysate | +Inquiry |
DCAKD-444HCL | Recombinant Human DCAKD cell lysate | +Inquiry |
NDOR1-3933HCL | Recombinant Human NDOR1 293 Cell Lysate | +Inquiry |
CTAGE6-416HCL | Recombinant Human CTAGE6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mtlA Products
Required fields are marked with *
My Review for All mtlA Products
Required fields are marked with *
0
Inquiry Basket